PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10034338
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 331aa    MW: 38457.6 Da    PI: 4.7905
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10034338genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-172976148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll ++++++G g+W+  a++ g++Rt+k+c++rw++yl
      Lus10034338 29 RGPWTLEEDTLLSHYIARHGEGRWNMLAKCAGLKRTGKSCRLRWLNYL 76
                     89********************************************97 PP

2Myb_DNA-binding45.91.3e-1482125146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+ E++l+++++ ++G++ W++I ++++ gRt++++k++w++
      Lus10034338  82 RGNLTPKEQLLILELHSKWGNR-WSRITQHLP-GRTDNEIKNYWRT 125
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.442476IPR017930Myb domain
SuperFamilySSF466891.12E-2927123IPR009057Homeodomain-like
SMARTSM007171.2E-142878IPR001005SANT/Myb domain
PfamPF002491.2E-152976IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-223083IPR009057Homeodomain-like
CDDcd001675.91E-113176No hitNo description
PROSITE patternPS0017504453IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129423.977131IPR017930Myb domain
SMARTSM007176.4E-1381129IPR001005SANT/Myb domain
PfamPF002491.8E-1382125IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-2284130IPR009057Homeodomain-like
CDDcd001672.37E-986125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MRAPFMNLQA HGGNHEEESS DQNHSEVRRG PWTLEEDTLL SHYIARHGEG RWNMLAKCAG  60
LKRTGKSCRL RWLNYLKPDI KRGNLTPKEQ LLILELHSKW GNRWSRITQH LPGRTDNEIK  120
NYWRTRVQRQ ARQLNIESNS KLFLDAVRCY WVPRLLQKVE QQTNYSPPQQ QQEEIETQHP  180
ITKVVAPDDS AASQEVEVEE TNLSNSASII AHSTDSTTIS YYDQQQQQPP SENVMESELI  240
GFPMEYNYYN SSNMMMLNYD YGMDGFDDTI APALMCHENN TVDGEINNNP EIMSAVSEQE  300
WQMGDNSYYD SLWNLDDTWQ YRGIREEMGI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-23291317108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012082112.11e-105PREDICTED: transcription factor MYB108
TrEMBLA0A067JZX51e-105A0A067JZX5_JATCU; MYB family protein
STRINGPOPTR_0008s12130.15e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.17e-85myb domain protein 62